Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318301.1	5prime_partial	129	458-69(-)
Amino Acid sequence :
STSFRQRLYNQSGNNKPDSTLDQSYAAQLRNRCPKSGGDQNLFFLDFVSPTKFDNSYFKLLLASKGLLNSDQVLTTKSQASLALVKQYAENNALFFDHFAKSMVKMGNISPLTGSSGEIR KNCRKINSS*
Physicochemical properties
Number of amino acids:		129
Molecular weight:		14,370.022
Theoretical pI:		9.735
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5960 6085
Instability index:		41.912
aromaticity		0.101
GRAVY		-0.557
Secondary Structure Fraction
Helix		0.271
turn		0.318
sheet		0.209