Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318314.1 | internal | 133 | 400-2(-) |
Amino Acid sequence : | |||
PFADNSFDGAYSIEATCHAPKLEEVYKEIYRVIKPGSYYVSYEWVTTELYQHEDPEHVEIIHGIERGDALPGLRSYKDIAEVAKQVGFEVVKEKDLAKPPSNPWWTRLKMGRIAYWRNHI LVTILAFLGIAPK | |||
Physicochemical properties | |||
Number of amino acids: | 133 | ||
Molecular weight: | 15,321.304 | ||
Theoretical pI: | 5.964 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35410 35410 | ||
Instability index: | 39.312 | ||
aromaticity | 0.128 | ||
GRAVY | -0.347 | ||
Secondary Structure Fraction | |||
Helix | 0.353 | ||
turn | 0.195 | ||
sheet | 0.256 |