Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318316.1 | internal | 144 | 434-3(-) |
Amino Acid sequence : | |||
SLLLLIILISFYPAIKVSMPSESGKVVCVTGAGGFIASWLVKLLLEKGYTVRGTVRNPDDPKNSHLRELEGAKERLTLCRADLLDYQSLKEAIYGCDGIFHTASPVTDDPEQMVEPAVIG TKNVITSAAEAKVRRVVFTSSIGA | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 15,549.867 | ||
Theoretical pI: | 6.696 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 31.070 | ||
aromaticity | 0.063 | ||
GRAVY | 0.171 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.229 | ||
sheet | 0.271 |