Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318321.1	internal	161	485-3(-)
Amino Acid sequence :
ARQAYHAKYKRSLEEDVAYHTTGDFRKLLVPLITAYRYEGDEVNMTLARKEANILHEKISDKAYNDEELIRIISTRSKAQLNATFNHYNDHHGHEIIKDLETDSDDEFLKLLGAAIECLK TPEKYFEKVLRLAIRKLGTNEWDLTRVVTTRAEVDMERIKE
Physicochemical properties
Number of amino acids:		161
Molecular weight:		18,838.075
Theoretical pI:		6.013
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		17420 17420
Instability index:		31.407
aromaticity		0.081
GRAVY		-0.684
Secondary Structure Fraction
Helix		0.298
turn		0.118
sheet		0.317