Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318327.1 | internal | 112 | 337-2(-) |
Amino Acid sequence : | |||
QNCDNDLENYCPGQIMTYNGIYSDGTTTYGGYSNIMVTDEHYVVHWPENLPMEAAPLLCAGITTYSPLKYFGLDKPGMHIGVVGLGGLGHMAVKFAKAFGTKVTVISTCPGG | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 11,997.567 | ||
Theoretical pI: | 5.327 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17670 | ||
Instability index: | 31.788 | ||
aromaticity | 0.107 | ||
GRAVY | -0.011 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.295 | ||
sheet | 0.205 |