Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318334.1 | internal | 170 | 1-510(+) |
Amino Acid sequence : | |||
PTKEDRINSWPEKPPQYREVIGKYTEGVRKASLTIMELMCEGLGLEKDHFANHQLSHIQYMAINLCPKCPDPNVTAGAVEHNDGGVINLILQELGGLHVRRHKDGQWFAVEPTPGALVCI NGMILKVISNGKLESGIHRVATNSVSDRISLGCLTSPACSGECTIEPAKA | |||
Physicochemical properties | |||
Number of amino acids: | 170 | ||
Molecular weight: | 18,494.063 | ||
Theoretical pI: | 6.419 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15845 | ||
Instability index: | 44.694 | ||
aromaticity | 0.041 | ||
GRAVY | -0.232 | ||
Secondary Structure Fraction | |||
Helix | 0.271 | ||
turn | 0.271 | ||
sheet | 0.253 |