Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318342.1 | internal | 175 | 525-1(-) |
Amino Acid sequence : | |||
PLFQPLVHHGFYNIYTSDSSRSKFNKTSARDQVLAEVKRLVEEYKDEEVSITVTGHSLGASLATLNAVDIAFNGINKTSEGKEFPVSAFVFASPKVGDLNFQKAFSKLKHLHILRIHNLL DIVPKYPPVGYFDVGQEIIIDTTKSPYLKLNPGDPHTRHNLESYLHGIDGTCPGG | |||
Physicochemical properties | |||
Number of amino acids: | 175 | ||
Molecular weight: | 19,405.743 | ||
Theoretical pI: | 6.880 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10430 | ||
Instability index: | 42.347 | ||
aromaticity | 0.097 | ||
GRAVY | -0.278 | ||
Secondary Structure Fraction | |||
Helix | 0.331 | ||
turn | 0.269 | ||
sheet | 0.200 |