Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318347.1 | 5prime_partial | 124 | 382-8(-) |
Amino Acid sequence : | |||
SHEWRIVTGCDPKNTSWSYHNGGSWPVLLWLLTAAAIKTGRPQIARRAIELAESRLLKDSWPEYYDGKLGRFIGKQARKFQTWSIAGYLVARMMLEDPSHLGMIALEEDKQMKPTMKRSA SWTC* | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 14,225.285 | ||
Theoretical pI: | 9.551 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 44460 44585 | ||
Instability index: | 43.435 | ||
aromaticity | 0.105 | ||
GRAVY | -0.453 | ||
Secondary Structure Fraction | |||
Helix | 0.282 | ||
turn | 0.218 | ||
sheet | 0.282 |