Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318353.1 | internal | 174 | 524-3(-) |
Amino Acid sequence : | |||
VAAEVHKHGNTAVSWIRNLFHDCMVKSCDASVYLDTTNGQESEKTSPRNFGMRNFKYIETIKQALEKECPNTVSCADIVALSARDGLLWLGGPRVEMRTGRKDSKESYLAEVENYLPNHN DSMSSVLSRFQSIGIDTEGTVALLGAHSVGRVHCVNLVHRLYPTVDPTIDPDYA | |||
Physicochemical properties | |||
Number of amino acids: | 174 | ||
Molecular weight: | 19,298.521 | ||
Theoretical pI: | 5.962 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20190 | ||
Instability index: | 35.970 | ||
aromaticity | 0.069 | ||
GRAVY | -0.352 | ||
Secondary Structure Fraction | |||
Helix | 0.282 | ||
turn | 0.247 | ||
sheet | 0.236 |