Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318374.1 | internal | 145 | 437-3(-) |
Amino Acid sequence : | |||
EFSGEVFENFTAVAERLRSDYDFAHTSDAKLLPRGDSSVSGPVVRLLKPFDELFVDFQEFDVDALAKFVEEASIPTVTVFNKDPDNHPFVIKFFNSPNAKAMLFVNFNNEIIDTFKSKYH EVAKQYKGNDISFLIGDVEASQGAF | |||
Physicochemical properties | |||
Number of amino acids: | 145 | ||
Molecular weight: | 16,357.061 | ||
Theoretical pI: | 4.633 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 23.777 | ||
aromaticity | 0.145 | ||
GRAVY | -0.197 | ||
Secondary Structure Fraction | |||
Helix | 0.345 | ||
turn | 0.228 | ||
sheet | 0.228 |