Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318383.1	internal	163	490-2(-)
Amino Acid sequence :
LKTRSSTVNENEKAGWKAAFNPQLSNFTVSQFKRLLGVLPPREGDLEGIPVVTHPKLMELPKEFDARKKWPQCSTIGKILDQGHCGSCWAFGAVEALSDRFCIRFNLSISLSVNDLLACC GFLCGNGCKGGNPIAAWRYFTRVGVVTEECDPYFDSIGCPHPG
Physicochemical properties
Number of amino acids:		163
Molecular weight:		17,897.388
Theoretical pI:		8.086
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		24980 25605
Instability index:		30.733
aromaticity		0.098
GRAVY		-0.142
Secondary Structure Fraction
Helix		0.294
turn		0.282
sheet		0.215