Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318388.1	internal	130	391-2(-)
Amino Acid sequence :
FIGAVDHVTPQESILELYMHDILGGSNPTARPITGLLGNIYSGQVPFARPLGFQPPKDGVAIPNANGAMPTFNINGVPLGTGLAGTTFAGGNNNNNNGQTLNTQLGPDGLGLGFGTITVI DDYLTSSPEL
Physicochemical properties
Number of amino acids:		130
Molecular weight:		13,347.765
Theoretical pI:		4.305
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		4470 4470
Instability index:		41.632
aromaticity		0.069
GRAVY		-0.029
Secondary Structure Fraction
Helix		0.292
turn		0.392
sheet		0.208