Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318391.1 | internal | 189 | 568-2(-) |
Amino Acid sequence : | |||
EQKAKLYVEGEQLSNEEFLYWKDTLAHGCHPLDQDLVNSWPEKPAKYREVVAKYSVEVRKLTMRMLDYICEGLGLKLGYFDNELSQIQMMLTNYYPPCPDPSSTLGSGGHYDGNLITLLQ QDLPGLQQLIVKDATRIAVQPIPTAFVVNLGLTLKVITNEKFEGSIHRVVTDPTRDRVSIATLIGPDYS | |||
Physicochemical properties | |||
Number of amino acids: | 189 | ||
Molecular weight: | 21,302.139 | ||
Theoretical pI: | 5.208 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26025 | ||
Instability index: | 26.154 | ||
aromaticity | 0.085 | ||
GRAVY | -0.268 | ||
Secondary Structure Fraction | |||
Helix | 0.339 | ||
turn | 0.222 | ||
sheet | 0.254 |