Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318395.1 | internal | 116 | 350-3(-) |
Amino Acid sequence : | |||
DYFKIGGFTPGNIPDAPPGGGIHLDTSVLQTDYRTFIEIIFENKEGIVQSWHLNGYAFWVVGMDGGKWTPASRDQYNLRDAVSRITTQVYPKSWTAIYIALDNVGMWNLRTEFWAR | |||
Physicochemical properties | |||
Number of amino acids: | 116 | ||
Molecular weight: | 13,232.731 | ||
Theoretical pI: | 5.548 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41940 41940 | ||
Instability index: | 33.616 | ||
aromaticity | 0.155 | ||
GRAVY | -0.289 | ||
Secondary Structure Fraction | |||
Helix | 0.353 | ||
turn | 0.250 | ||
sheet | 0.164 |