Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318398.1 | 5prime_partial | 117 | 364-11(-) |
Amino Acid sequence : | |||
DVPIRRYPKKNDATFPQRPMYVYGSIWDASSWATDNGRIKADYKYQPFVGKYSNNFKIAGCTANESPSCRQAPSSSPSRGGGLSRQQIEAMLWVQRNHKVYDYCRDPRRDHTHTPEC* | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 13,476.877 | ||
Theoretical pI: | 9.415 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28670 | ||
Instability index: | 70.252 | ||
aromaticity | 0.120 | ||
GRAVY | -1.055 | ||
Secondary Structure Fraction | |||
Helix | 0.222 | ||
turn | 0.291 | ||
sheet | 0.128 |