Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318402.1	internal	168	504-1(-)
Amino Acid sequence :
GACIRKALCFIQSIQLPDGSWYGSRGVCYTYGTWFGISGLVAGGMTYESSKSIRKACHFLLSKQLQPSGGWGESYLSSQHKVYTNIEGNKPHNVNTAWAMLALIEAGQDKRDPTPLHRAA KILINSQMENGDFPQQEIIGVFNKNCMISYSAYRNIFPIWALGAYLNQ
Physicochemical properties
Number of amino acids:		168
Molecular weight:		18,675.123
Theoretical pI:		8.983
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		40910 41160
Instability index:		49.356
aromaticity		0.119
GRAVY		-0.218
Secondary Structure Fraction
Helix		0.310
turn		0.292
sheet		0.214