Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318403.1 | internal | 164 | 493-2(-) |
Amino Acid sequence : | |||
ILTDTELQNWWKELREVGHGDKKDEPWWPEMESPEDLIDSCTIIIWTASALHAAVNFGQYPYAGYLPNRPTVSRRFMPEPGTPEYEELKTNPDKAFLKTITAQLQTLLGVSLIEILSRHT TDEIYLGQRDSAEWTKDKEPLAAFERFGKKLSDIEMRIIQMNGD | |||
Physicochemical properties | |||
Number of amino acids: | 164 | ||
Molecular weight: | 18,926.165 | ||
Theoretical pI: | 4.807 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40450 40450 | ||
Instability index: | 46.155 | ||
aromaticity | 0.098 | ||
GRAVY | -0.585 | ||
Secondary Structure Fraction | |||
Helix | 0.293 | ||
turn | 0.201 | ||
sheet | 0.287 |