Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318404.1 | internal | 138 | 2-415(+) |
Amino Acid sequence : | |||
ASLISSWAAQVNSVPERYVVPSEKRFNINVPIGKDIPVIDLSLPSQNIVAEIIKASQEYGVFQVINHGVSKELIADVLKVCGEFFKLPIEELEKYTEEEELSEFEPNLDQKPKLFIEKEY KPKKNDKEVIFWKDTFAH | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 15,850.932 | ||
Theoretical pI: | 4.935 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
Instability index: | 45.467 | ||
aromaticity | 0.101 | ||
GRAVY | -0.317 | ||
Secondary Structure Fraction | |||
Helix | 0.362 | ||
turn | 0.217 | ||
sheet | 0.254 |