Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318405.1 | internal | 106 | 319-2(-) |
Amino Acid sequence : | |||
GKDIPVIDLSLPSQNIVAEIIKASQEYGVFQVINHGVSKELIADVLKVCGEFFKLPIEELEKYTEEEELSEFEPNLDQKPKLFIEKEYKPKKNDKEVIFWKDTFAH | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 12,296.915 | ||
Theoretical pI: | 4.778 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 39.252 | ||
aromaticity | 0.104 | ||
GRAVY | -0.427 | ||
Secondary Structure Fraction | |||
Helix | 0.358 | ||
turn | 0.179 | ||
sheet | 0.274 |