Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318419.1 | internal | 163 | 491-3(-) |
Amino Acid sequence : | |||
PRPSATAYSHKDVGLEQQKSFAKDFEPRPSATAYYHEELGLEQKKPFAKDFEPRPTLTAYYHDDADAGVEQQKVSFVKDLKPRPTITAYDHDDAGLEQEKSSISKDFKPRLTITAYYLDE ASLKQEKSPFAKNIKPRDSATSYRHNEDHLKEGKSFEPRPNVS | |||
Physicochemical properties | |||
Number of amino acids: | 163 | ||
Molecular weight: | 18,621.336 | ||
Theoretical pI: | 6.357 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13410 13410 | ||
Instability index: | 42.503 | ||
aromaticity | 0.104 | ||
GRAVY | -1.139 | ||
Secondary Structure Fraction | |||
Helix | 0.221 | ||
turn | 0.221 | ||
sheet | 0.239 |