Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318423.1 | internal | 104 | 312-1(-) |
Amino Acid sequence : | |||
AKGLKLSGDGKDVWVFDIDETTLSNMPYYARSDVAFGAIPFNKTKFNAWIAEGKAPAIPSILGVYKMVLSLGIKPVIITGSLENFRYARIVNLKKVGYSNWAKL | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 11,470.277 | ||
Theoretical pI: | 9.657 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 23950 | ||
Instability index: | 22.126 | ||
aromaticity | 0.125 | ||
GRAVY | 0.091 | ||
Secondary Structure Fraction | |||
Helix | 0.375 | ||
turn | 0.260 | ||
sheet | 0.231 |