Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318436.1 | 3prime_partial | 113 | 340-2(-) |
Amino Acid sequence : | |||
MHDILGGSNPTARPITGLLGNIYSGQVPFARPLGFQPPKDGVAIPNANGAMPTFNINGVPLGTGLAGTTFAGVNNNNNNNGETVNTQLGPDGLGLGFGTITVIDDYLTSSPEL | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 11,477.657 | ||
Theoretical pI: | 4.324 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 37.509 | ||
aromaticity | 0.062 | ||
GRAVY | -0.088 | ||
Secondary Structure Fraction | |||
Helix | 0.274 | ||
turn | 0.425 | ||
sheet | 0.195 |