Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318438.1 | internal | 112 | 337-2(-) |
Amino Acid sequence : | |||
PGQVDIPVIDLSLPSQNIVDQIIKASQEYGLFQVINHGVSKELIGDVLKVCGEFFKLPIEELEKYTDEEEELSEFEPNLDQKSKLFIEKEYKPKKNGKSDKEVIFWKDTFAH | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 12,913.494 | ||
Theoretical pI: | 4.685 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 30.978 | ||
aromaticity | 0.098 | ||
GRAVY | -0.518 | ||
Secondary Structure Fraction | |||
Helix | 0.348 | ||
turn | 0.205 | ||
sheet | 0.241 |