Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318446.1 | internal | 153 | 3-461(+) |
Amino Acid sequence : | |||
ATAVNGGANPAFPANKAQLYNPTRPTYRPIPPPRRKHRRSCCCYCCLFVTFLIVAIILLAAIAGAIFWVLYRPKTPSFRVQSLQVTQFNLTSPKFTSKFNLTVIAHNPNKRISFFYDPIN INFSSDDVDIGDGSLPAFTQDTKASKTLRGDVA | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 16,984.444 | ||
Theoretical pI: | 9.869 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13200 | ||
Instability index: | 51.582 | ||
aromaticity | 0.118 | ||
GRAVY | -0.039 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.261 | ||
sheet | 0.170 |