Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318455.1	internal	142	427-2(-)
Amino Acid sequence :
DKLCDQISDAVLDACLEQDPESKVACETCTKTNLVMVFGEITTKAVVDYEKIVRNTCRNIGFVSDDVGLDADNCKVLVYIEQQSPDIAQGVHGHLTKRPEEIGTGDQGHMFGYATDETPE LMPLSHVLATKLGARLTEVRKN
Physicochemical properties
Number of amino acids:		142
Molecular weight:		15,582.468
Theoretical pI:		4.719
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		4470 4845
Instability index:		46.930
aromaticity		0.042
GRAVY		-0.282
Secondary Structure Fraction
Helix		0.275
turn		0.176
sheet		0.246