Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318461.1 | internal | 157 | 472-2(-) |
Amino Acid sequence : | |||
SFLLFLVIAIKLTRESKSGKESNLPPGPRKLPLIGNLHQLMGSLPHHTLRDMAKEYGPIMHLRFGEVPTVIISSAEAAKEVMKTHDLVFADRPKILVADIIGYNSTQITFSPYGDHWRQL RKICVAELLNVKRVQSFESIRQEEVEDLIKTISSNPA | |||
Physicochemical properties | |||
Number of amino acids: | 157 | ||
Molecular weight: | 17,684.403 | ||
Theoretical pI: | 9.067 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 38.980 | ||
aromaticity | 0.064 | ||
GRAVY | -0.127 | ||
Secondary Structure Fraction | |||
Helix | 0.331 | ||
turn | 0.229 | ||
sheet | 0.268 |