Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318463.1 | internal | 174 | 523-2(-) |
Amino Acid sequence : | |||
HPTKEDRSNSWPQNPPQYREVIGKYTEGVRKASLRIMELMCEGLGLEKDHFANELSHIQYMAINLYPKCPDPNVTAGAVEHNDGGVINLILQELGGLHVRRHKDGQWFAVEPIPGALVCI NGMILKVISNGKLESGIHRVATNSVSDRISLGCLTSPACSGECIIEPAKALLSE | |||
Physicochemical properties | |||
Number of amino acids: | 174 | ||
Molecular weight: | 19,035.639 | ||
Theoretical pI: | 6.177 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17335 | ||
Instability index: | 46.409 | ||
aromaticity | 0.046 | ||
GRAVY | -0.220 | ||
Secondary Structure Fraction | |||
Helix | 0.287 | ||
turn | 0.282 | ||
sheet | 0.264 |