Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318470.1 | internal | 140 | 2-421(+) |
Amino Acid sequence : | |||
PSGQWPCAPGRKYFGRGPIQISHNYNYGPCGRAIGVDLLNNPDLVATDPVISFKSALWFWMTPQSPKPSCHDVITGRWQPSGADRAANRLPGFGVITNIINGGLECGHGSDSRVQDRIGF YRRYCGIIGVSPGDNLDCGN | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 15,161.916 | ||
Theoretical pI: | 8.684 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29825 | ||
Instability index: | 47.209 | ||
aromaticity | 0.100 | ||
GRAVY | -0.364 | ||
Secondary Structure Fraction | |||
Helix | 0.279 | ||
turn | 0.371 | ||
sheet | 0.114 |