Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318471.1 | internal | 158 | 475-2(-) |
Amino Acid sequence : | |||
YNIYTSDSSRSKFNKTSARDQVLAEVKRLVEEYKDEEVSITVTGHSLGASLATLNAVDIAFNGINKTSEGKEFPVSAFVFASPKVGDLNFQKAFSKLKHLHILRIHNLLDIVPKYPPVGY FDVGQEIIIDTTKSPYLKLNPGDPHTRHNLEGYLHGID | |||
Physicochemical properties | |||
Number of amino acids: | 158 | ||
Molecular weight: | 17,629.718 | ||
Theoretical pI: | 6.720 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10430 | ||
Instability index: | 39.983 | ||
aromaticity | 0.095 | ||
GRAVY | -0.324 | ||
Secondary Structure Fraction | |||
Helix | 0.335 | ||
turn | 0.253 | ||
sheet | 0.209 |