Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318475.1 | internal | 123 | 2-370(+) |
Amino Acid sequence : | |||
HPSGRVVTGIVASSDANNLPFSKVNNRVFPIDGGVPLNNINNIVNNNNYPFLAGLNGQQQSNTVLQNTGNNNIVNSGDNQPFVTAGQLPAGLSLQQLMFGSITVVDNEITEGHELGSSIL GST | |||
Physicochemical properties | |||
Number of amino acids: | 123 | ||
Molecular weight: | 12,871.014 | ||
Theoretical pI: | 4.635 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 48.127 | ||
aromaticity | 0.049 | ||
GRAVY | -0.195 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.431 | ||
sheet | 0.163 |