Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318477.1	internal	180	541-2(-)
Amino Acid sequence :
YGNQDSAITAEHIEDKLDGLTVDEAIRRNKLFILNHHDTLIPYLRSINTTTTKTYASRTLLFLQDNGSLKPLAIELSLPHPDGDQFGAISKVYTPSDQGVENTIWQLAKAYAAVNDSGVH QLISHWLNTHAVIEPFVIATNRQLSVLHPIHKLLYPHFRDTMNINAMARQVLINAGGVLE
Physicochemical properties
Number of amino acids:		180
Molecular weight:		20,114.579
Theoretical pI:		6.191
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		19940 19940
Instability index:		39.485
aromaticity		0.072
GRAVY		-0.165
Secondary Structure Fraction
Helix		0.333
turn		0.217
sheet		0.256