Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318483.1 | internal | 102 | 307-2(-) |
Amino Acid sequence : | |||
QSLPSQNIVDQIIKASQEYGLFQVINHGVSKELIGDVLKVCGEFFKLPIEELEKYTDEEEELSEFEPNLDQKPKLFIEKEYKPKKNGKSDKEVIFWKDTFAH | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 12,328.510 | ||
Theoretical pI: | 9.357 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
Instability index: | 35.898 | ||
aromaticity | 0.222 | ||
GRAVY | 0.454 | ||
Secondary Structure Fraction | |||
Helix | 0.525 | ||
turn | 0.152 | ||
sheet | 0.242 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318483.1 | complete | 99 | 2-301(+) |
Amino Acid sequence : | |||
MRKCIFPENYFFITLAILLRFIFFFNEKFWFLIQIWLKFTQLFFFISILLQFLNWQLEKLPTNFQNITNQLFRDSMVNHLKESILLGSFDDLINYILRR* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 12,328.510 | ||
Theoretical pI: | 9.357 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
Instability index: | 35.898 | ||
aromaticity | 0.222 | ||
GRAVY | 0.454 | ||
Secondary Structure Fraction | |||
Helix | 0.525 | ||
turn | 0.152 | ||
sheet | 0.242 |