Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318491.1 | internal | 186 | 1-558(+) |
Amino Acid sequence : | |||
EIVKSVVAKAVAKEARMAASLLRLHFHDCFVKGCDASLLLDSSRGIVTEKRSNPNRNSARGFEVIDEIKSALEKECPQTVSCADILALAARDSTVLAGGPNWEVPLGRRDSRGASLSGSN NDIPAPSNTFNTILTKFKRQGLDLVDLVALSGSHTIGNSRCTSFRQRLYNQPGNSQPDSTLDQSYA | |||
Physicochemical properties | |||
Number of amino acids: | 186 | ||
Molecular weight: | 20,061.360 | ||
Theoretical pI: | 8.673 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 46.560 | ||
aromaticity | 0.048 | ||
GRAVY | -0.323 | ||
Secondary Structure Fraction | |||
Helix | 0.258 | ||
turn | 0.285 | ||
sheet | 0.247 |