Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318493.1 | 3prime_partial | 136 | 408-1(-) |
Amino Acid sequence : | |||
MNINALARQMLVNCGGFVETLVFPAQYSMEMSAVVYKDWVFPEQALPADLIKRGVAVEDSSSPDGIRLLIQDYPYAADGMKIWSAIKSWVTEYCNFYYKSDDAVEKDGELQAWWKELREE GHGDKKEESWWPKMQT | |||
Physicochemical properties | |||
Number of amino acids: | 136 | ||
Molecular weight: | 15,682.605 | ||
Theoretical pI: | 4.619 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 48930 49055 | ||
Instability index: | 49.267 | ||
aromaticity | 0.132 | ||
GRAVY | -0.421 | ||
Secondary Structure Fraction | |||
Helix | 0.316 | ||
turn | 0.199 | ||
sheet | 0.287 |