Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318495.1 | internal | 128 | 384-1(-) |
Amino Acid sequence : | |||
KNVKDFWPDVKIKYIAVGNEISPVTGTSYLTSFLVPAMVNIYRAVGEAGLGNNIKVSTSVDMTLIGNSYPPSQGSFRNDARWFTDPIVGFLRDTRAPLLVNIYPYFSYSGNPGQISLPYA LFTAPNVV | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 14,055.881 | ||
Theoretical pI: | 8.935 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 22920 | ||
Instability index: | 33.136 | ||
aromaticity | 0.133 | ||
GRAVY | 0.054 | ||
Secondary Structure Fraction | |||
Helix | 0.375 | ||
turn | 0.328 | ||
sheet | 0.164 |