Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318504.1	internal	145	436-2(-)
Amino Acid sequence :
LFEPGELSSWSFYRAGIAEFVATFLFLYITILTVMGLKRSDSLCSSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFMQGPY QRHGGGANVVNPGYTKGDGLGAEII
Physicochemical properties
Number of amino acids:		145
Molecular weight:		15,314.786
Theoretical pI:		8.774
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		19940 20190
Instability index:		25.978
aromaticity		0.131
GRAVY		0.688
Secondary Structure Fraction
Helix		0.386
turn		0.269
sheet		0.248