Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318512.1 | 5prime_partial | 165 | 3-500(+) |
Amino Acid sequence : | |||
DVIDSCTIIIWVASALHAAVNFGQYPYGGYLVNRPTLSRNFMPEPGNPECEELKTNPDKVFLKTIVSQWQTLLEISVLEVLSRHASDEVYLGQRDSPEWTRDQEPLSAFERFGKKLSDIE HQIMQMNADEKWKNRSGPVKVPYTLLFPTSDEGLTGKGIPNSISI* | |||
Physicochemical properties | |||
Number of amino acids: | 165 | ||
Molecular weight: | 18,638.896 | ||
Theoretical pI: | 5.069 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29575 | ||
Instability index: | 34.128 | ||
aromaticity | 0.091 | ||
GRAVY | -0.386 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.267 | ||
sheet | 0.230 |