Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318523.1	5prime_partial	127	452-69(-)
Amino Acid sequence :
SFRQRLYNQSGNNKPDSTLDQSYAAQLRNRCPKSGGDQNLFFLDFVSPTKFDNSYFKLLLASKGLLNSDQVLTTKSRASLALVKQYAENNALFFDHFAKSMVKMGNISPLTGSSGEIRKN CRKINSS*
Physicochemical properties
Number of amino acids:		127
Molecular weight:		14,209.898
Theoretical pI:		9.848
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5960 6085
Instability index:		42.414
aromaticity		0.102
GRAVY		-0.562
Secondary Structure Fraction
Helix		0.276
turn		0.315
sheet		0.213