Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318524.1 | internal | 106 | 3-320(+) |
Amino Acid sequence : | |||
VAKKPSWKVGSSFSIKKITKSLPKVQIDDDSDFIDEDSLLSEEDLKKPQLPSVGDCEVGKTRKACKNCSCGRAELETKVQLGPTVEQLANPQSACGSCGLGDAFRC | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 11,390.858 | ||
Theoretical pI: | 6.430 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5875 | ||
Instability index: | 44.502 | ||
aromaticity | 0.038 | ||
GRAVY | -0.495 | ||
Secondary Structure Fraction | |||
Helix | 0.226 | ||
turn | 0.264 | ||
sheet | 0.208 |