Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318525.1 | internal | 136 | 410-3(-) |
Amino Acid sequence : | |||
VEVKCGGHSIHDIFHMNTHHITKISPNKVQHFEVHEGETIKVGSIVGWKYSDDGKDKTCKQVIEAVDLEKKSITWKVIGGDLLELYNSFTIITSCDDHWTTWTLLYEKKTEDTPEPLVFL GYALHVTKEVEDHLVK | |||
Physicochemical properties | |||
Number of amino acids: | 136 | ||
Molecular weight: | 15,573.521 | ||
Theoretical pI: | 5.756 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
Instability index: | 21.418 | ||
aromaticity | 0.088 | ||
GRAVY | -0.372 | ||
Secondary Structure Fraction | |||
Helix | 0.338 | ||
turn | 0.162 | ||
sheet | 0.184 |