Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318529.1 | internal | 177 | 532-2(-) |
Amino Acid sequence : | |||
HGNVDRMWNEWKQIGGKRRDLTDKDWLNSEFFFYDENRNPWRVRVRDCLDSKKMGYDYSPMPTPWRNFKPSRKSTIGKVNTSSLPPVSQVFPLAKMDKPISFSINRPASSRTQTEKDEQE EMLTFNDIKYDDREYIRFDVFLNTDNNVNADGLDKVEFAGSYTSLPRVHANHNAAPE | |||
Physicochemical properties | |||
Number of amino acids: | 177 | ||
Molecular weight: | 20,774.882 | ||
Theoretical pI: | 7.039 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36440 | ||
Instability index: | 47.072 | ||
aromaticity | 0.119 | ||
GRAVY | -1.019 | ||
Secondary Structure Fraction | |||
Helix | 0.260 | ||
turn | 0.271 | ||
sheet | 0.175 |