Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318548.1	internal	99	298-2(-)
Amino Acid sequence :
ATQEEHDQRFNVFKANLRRARRHQMLDPTAEHGITKFSDLTPSEFRRTYLGLHKPKPKFNAEKAPILPTSDLPADFDWREKGAVTGVKNQGSCGSCWSF
Physicochemical properties
Number of amino acids:		99
Molecular weight:		11,315.603
Theoretical pI:		9.343
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12615
Instability index:		49.287
aromaticity		0.101
GRAVY		-0.882
Secondary Structure Fraction
Helix		0.222
turn		0.232
sheet		0.222