Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318548.1 | internal | 99 | 298-2(-) |
Amino Acid sequence : | |||
ATQEEHDQRFNVFKANLRRARRHQMLDPTAEHGITKFSDLTPSEFRRTYLGLHKPKPKFNAEKAPILPTSDLPADFDWREKGAVTGVKNQGSCGSCWSF | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,315.603 | ||
Theoretical pI: | 9.343 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 49.287 | ||
aromaticity | 0.101 | ||
GRAVY | -0.882 | ||
Secondary Structure Fraction | |||
Helix | 0.222 | ||
turn | 0.232 | ||
sheet | 0.222 |