Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318557.1 | internal | 169 | 508-2(-) |
Amino Acid sequence : | |||
RINSWPEKPPQYREVIGKYTEGVRKASLTIMELMCEGLGLEKDHFANHPLSHIQYMAINLYPKCPDPNVTAGAVEHNDGGVINLILQELGGLHVRRHKDGQWFAVEPIPGALVCINGMIL KVISNGKLESGIHRVATNSVSDRISLGCLTSPACSGECIIEPAKALLNE | |||
Physicochemical properties | |||
Number of amino acids: | 169 | ||
Molecular weight: | 18,446.126 | ||
Theoretical pI: | 6.406 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17335 | ||
Instability index: | 41.526 | ||
aromaticity | 0.047 | ||
GRAVY | -0.102 | ||
Secondary Structure Fraction | |||
Helix | 0.302 | ||
turn | 0.278 | ||
sheet | 0.266 |