Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318564.1	internal	121	363-1(-)
Amino Acid sequence :
EKSESTKIDIVETNKERKGKAPLLGTAVPVVAAATTAEHAKGGAKRGIAIFDLILRIAAFASALGAAVAMGTTEETLPFFTQFFQFEASYDDLPTFTFFVVAMAIVVAYLVLSVPFSIVC I
Physicochemical properties
Number of amino acids:		121
Molecular weight:		12,862.842
Theoretical pI:		5.315
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		2980 2980
Instability index:		32.155
aromaticity		0.107
GRAVY		0.626
Secondary Structure Fraction
Helix		0.355
turn		0.157
sheet		0.322