Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318570.1 | 3prime_partial | 111 | 335-3(-) |
Amino Acid sequence : | |||
MTGGVSKEEEMDVTLNLLKKKMDDFAKERDWEKFHSPRNLLLAMVGEVGELSEIFQWKGEVPKGLPDWEENEKLHLGEELSDVLLYLVRLSDICGIDLGQAALRKLQLNAI | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 12,653.437 | ||
Theoretical pI: | 4.745 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
Instability index: | 29.726 | ||
aromaticity | 0.063 | ||
GRAVY | -0.321 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.189 | ||
sheet | 0.378 |