Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318575.1 | internal | 188 | 1-564(+) |
Amino Acid sequence : | |||
YYFIRLMGRKASHVALECTLQSHPNMVILGEEVAASKLTLFDITNKICDAVQARAEQDKNHGVILLPEGLIESIPEVYALLQEIHGLLTQGVSADKISSQLSPWASALFEFLPPFIKKQL LLHPESDDSAQLSQIETEKLIAHLVETEMNKRLKEGTYKGKKFNAICHFFGYQARGSLPSKFDCDYAY | |||
Physicochemical properties | |||
Number of amino acids: | 188 | ||
Molecular weight: | 21,113.061 | ||
Theoretical pI: | 5.978 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16180 | ||
Instability index: | 54.427 | ||
aromaticity | 0.090 | ||
GRAVY | -0.119 | ||
Secondary Structure Fraction | |||
Helix | 0.330 | ||
turn | 0.197 | ||
sheet | 0.309 |