Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318576.1	internal	119	359-3(-)
Amino Acid sequence :
LLIVNGFLVLITYLQHTHPSLPHYDSTEWDWLRGALATVDRDYGILNKVFHNITDTHVVHHLFSTMPHYNAMDATKAVKPLLGDYYQFDGTPVVTAMWREAKECLYVEKDEASQGKGVF
Physicochemical properties
Number of amino acids:		119
Molecular weight:		13,635.344
Theoretical pI:		5.833
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		26930 26930
Instability index:		39.560
aromaticity		0.126
GRAVY		-0.156
Secondary Structure Fraction
Helix		0.361
turn		0.168
sheet		0.244