Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318590.1 | internal | 170 | 2-511(+) |
Amino Acid sequence : | |||
DSGDNEVTIDLSPLLRVFKDGHVERMFGSPIVPPSLEDPTTGVASKDIDISPDIRARVYLPKLTNTTNEKLPILVYYHGGGFCLESAFSFLDHRYLNLIVSEAKVIAISVEYRLAPEHPL PIAYEDSWTALQWVVSHVLENPGFEKEPWLVNHGNFEKVLIGGDSAGGNI | |||
Physicochemical properties | |||
Number of amino acids: | 170 | ||
Molecular weight: | 18,828.080 | ||
Theoretical pI: | 4.834 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25440 | ||
Instability index: | 32.896 | ||
aromaticity | 0.094 | ||
GRAVY | -0.089 | ||
Secondary Structure Fraction | |||
Helix | 0.359 | ||
turn | 0.276 | ||
sheet | 0.241 |