Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318591.1 | internal | 193 | 3-581(+) |
Amino Acid sequence : | |||
NIISDEPTPYGDGFIRFEFFDGWEYTQPNENHQLEIELVNLEAVGRAVLPAMLKENEAKGRPVSCLINNPFIPWVCDVADSLGIPCAVLWVQSCASFSAYYHYHFNLARFPNESNPNIDV HLPNMPVLKWDELPSFLLPSNPFPALANAILKQFNYLSKPVRIFIESFDELEKDIVDYMSDILPIKTVGPLLV | |||
Physicochemical properties | |||
Number of amino acids: | 193 | ||
Molecular weight: | 21,942.863 | ||
Theoretical pI: | 4.534 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32430 32680 | ||
Instability index: | 57.116 | ||
aromaticity | 0.124 | ||
GRAVY | 0.006 | ||
Secondary Structure Fraction | |||
Helix | 0.378 | ||
turn | 0.275 | ||
sheet | 0.259 |