Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318595.1 | internal | 99 | 299-3(-) |
Amino Acid sequence : | |||
GRPGRCRPPLAIMGRMHSRGKGISASAPPYRRTPPSWLKISAPDVEDNICKFAKKGLTPSQIGVILRDSHGIAQVKSVTGSKILRILKAHGLAPEIPED | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 10,658.384 | ||
Theoretical pI: | 10.489 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 54.465 | ||
aromaticity | 0.030 | ||
GRAVY | -0.354 | ||
Secondary Structure Fraction | |||
Helix | 0.242 | ||
turn | 0.313 | ||
sheet | 0.202 |